<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6045 6045-30515 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, V82C, L90M G73S I15V, K20T, E35D, N37T, I62V, L63P, A71V, V77I, C95L  
>6045-30515| codons 1-99
PQITLWQRPLVTIKVGGQLTEALLDTGADDTILEDMTLPGRWKPKIVGGIGGFIKVRQYD
QVPIEICGHKVISTVLIGPTPCNIIGRNLMTQIGLTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215Y K219E     R83K, D123E, E138A, L228LF, A272P, K277R, T286P, E291D, E297K, I326T, Q334L, F346Y, A360V, A376AT, T377Q  
>6045-30515| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDEKHQKEPPFFWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGPKALTDVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLTAEIQKQGLGQWTYQIYQEPYKNLKTGKYARMRGV
HTNDVKQLTEAVQKITQESIVIWGKTPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006