<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6044 6044-30507 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, V82A, L90M L33I, L89V L10I, I13A, K20M, A22V, E35N, M36I, R41K, R57K, D60E, I62V, L63P, A71T, I72M, T74E, Q92K  
>6044-30507| codons 1-99
PQITLWQRPIVTAKIGGQLMEVLLDTGADDTVIENINLPGKWKPKIVGGIGGFVKVKQYE
QVPIEICGHKTMGEVLVGPTPANIIGRNVMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219N Y181V   V35M, T39A, E40F, K43E, T69N, K122E, T200A, V245Q, T286A, A288S, E297A, Q334L, A371V, A376V, E399D  
>6044-30507| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAFLEEEGKISKIGPENPYNTPV
FAIKKKNSNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
VQYVDDLYVGSDLEIGQHRAKIEELRQHLWRWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKSLTEVIPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGLGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEVVQKIVTESIVIWGKTPKFKLPIQKETWD

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006