<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6043 6043-30505 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, I84V, L90M G73S L10I, T12N, I15V, G16GA, L19P, K20I, M36I, L63P, A71V, I72L, I85V, I93L  
>6043-30505| codons 1-99
PQITLWQRPIVNIKVAGQPIEALLDTGADDTVLEEINLPGRWKPKIVGGIGGFVKVRQYD
QIPIEICGHKVLSTVLVGPTPVNVVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y   V106A, Y181YC, G190A F227FL K20R, V35I, K43E, A98S, K102Q, V118I, D123E, I135T, G196E, H208Y, R211K, K223Q, E224D, A272P, E297K, G335S, Y342F, M357R, R358K, K366R, A371V, A376ST, T386V, K390R  
>6043-30505| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLKQKKSATVLDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVASDLEIEQHRTKIEELRQYLWKWGFYTPDKKHQQDPPLLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQSQWTYQIFQEPFKNLKTGKYARRKGA
HTNDVRQLTEVVQKITTESIVIWGKVPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006