<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6042 6042-30430 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48GA, I54IV, V82VA, L90M L33LF, G73S L10LI, K20KR, M36I, R41K, K45KR, I62V, L63LP, C67CF, A71AV, I72IM  
>6042-30430| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVFEEINLPGKWKPRMIAGIGGFVKVRQYD
QVPIEIFGHKVMSTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69DE, L210W, T215Y       P4PT, K122Q, D123E, E169K, K173E, A272P, E297K, M357T, A371V, I375V, A376T, E399D  
>6042-30430| codons 1-399
PISTIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSEKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DQEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILKPFREQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEVVQKVTTESIVIWGKTPKFKLPIQKETWD

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006