<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6027 6027-30409 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K65R, D67N, Q151M, M184I, T215Y A62V, V75I, F116Y, K219E Y181C, G190A K101NS, V108I I31R, K49R, S68K, V90I, K122E, S162D, R172K, V189VI, I202V, A272P, V276T, Q278E, E297A, E298A, M357T, R358K, T369A, A376N, T386S, K390KR I309IS
>6027-30409| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKRKALVEICTELEKEGKISRIGPENPYNTPV
FVIKRKNKTKWRKLIDFRELNKRTQDFWEIQLGIPHPAGLSKKKSVTILDVGDAYYSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQDSMTKILEPFKKQNPDIVI
CQYIDDLYIASDLEIGQHRTKVEELRQHLLRWGFYTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKTKELCKLLRGTKALTEVIPLTAAAE
LELAENRESLKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTKGA
HTNDVKQLAEAVQKINTESIVIWGKSPKFRLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54M, I84V, L90M V11I, G73S L10I, I13V, I15V, G16A, K20IV, M36I, R41K, L63P, A71V, I72L, I85V  
>6027-30409| codons 1-99
PQITLWQRPIITVKVAGQLVEALLDTGADDTVLEEINLPGKWKPKIVGGIGGFMKVRQYD
QIPIEICGHKVLSTVLVGPTPVNVVGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006