<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6024 6024-30407 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, V75T, M184V, T215F K219Q Y181C   K20R, V35I, T39A, K43E, T69N, V118VI, D123E, I135L, S162SDGN, Q207E, R211K, F214L, D218E, L228H, A272P, K281KR, R284K, T286A, I293V, E297K, Q334L, M357V, T386V L282LF
>6024-30407| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICAELEEEGKISKIGPENPYNTPV
FAIKKKNSNKWRKITDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKQNPDIVI
CQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGLFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRFLKGAKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGLGQWTYQIYQEPFKNLKTGKYARVRGA
HTNDVKQLTEAVQKIATESIVIWGKVPKFKLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L33F, Q58E, G73GS L10V, T12I, I13V, L24F, N37D, K55R, D60E, L63P, A71V, V77I, I93L  
>6024-30407| codons 1-99
PQITLWQRPVVIVKIGGQLKEALFDTGADDTVFEEMDLPGRWKPKLIGGIGGFVRVREYE
QIPIEICGHKVISTVLIGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006