<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6018 6018-30321 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184MV, L210W, T215Y K219R K101E, Y181C, G190A A98G, V108I E28K, K32E, K43N, E44D, V60I, V118I, D123E, E138D, I178M, V189I, G196E, E203K, R211K, K223Q, D237N, A272P, K281R, T286TA, V292I, I293V, E297T, V317VA, I329V, G335S, R358K, G359S, T369TA, A371V N54NI
>6018-30321| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEALVEICTELENDGKISKIGPEIPYNTPI
FAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHPGGLEKKKSVTILDVGDAYFSIPL
DKEFRKYTAFTIPSINNDTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
CQYVDDLYIASDLEIEQHRTKIKELRQHLWKWGFYTPDRKHQQEPPFLWMGYELHPNKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTEIVPLTTEAE
LELAENREILKEPVHGAYYDPSKDLIAEVQKQGQSQWTYQIYQEPFKNLKTGKYARMKSA
HTNDVKQLAEVVQKIATESIVIWGKTPKFKLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M L10FI, L33F, F53L V11VL, G16A, E34Q, G51A, K55R, Q61N, L63P, A71L, I72IM, V77I, C95L  
>6018-30321| codons 1-99
PQITLWQRPILTIKIAGQLKEALLDTGADDTVFQEMNLPGRWKPKIIGGIAGLVRVRQYD
NIPIEICGHKLMGTVLIGPTPANIIGRNLMTQIGLTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006