<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6015 6015-30904 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 24

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, Y115F, Q151M, M184V, T215Y K70N K101E, Y181C, G190A V108I E28A, S68G, K122E, D123DE, I135T, S162A, K166R, R172K, K173N, T200TA, F214L, A272P, I293V, E297R, E312ED, M357T, A360T, K366R, T386TI  
>6015-30904| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTNWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTILDVGDAFFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQASMTRILEPFKNQNPDIVI
CQYVDDLYVASDLEIGQHRAKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTREAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGT
HTNDVRQLTEAVQKIATESIVIWGKIPKFKLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54A, I84V, L90M L10FI, G73S, L89V V11L, I13V, K14KR, I15V, K20I, L33V, I62V, L63P, A71V, I72L  
>6015-30904| codons 1-99
PQITLWQRPILTVRVGGQLIEALLDTGADDTVVEEMNLPGRWKPKIIGGIGGFAKVRQYD
QVPIEICGHKVLSTVLVGPTPVNVIGRNVMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006