<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6003 6003-30218 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, V82A, L90M L33F, G73S L10I, E34EQ, E35D, M36I, K43S, K55R, I62V, L63P, C67F, H69K, A71V C95CFGV
>6003-30218| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVFQDINLPGRWSPKIIGGVGGFVRVRQYD
QVPIEIFGKKVISTVLVGPTPANIIGRNLMTQIGVTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69G_SG, T215Y       V35I, K64KR, A98S, K122KE, D123DE, I178IM, R211K, L228H, V245E, K249KQ, A272P, K281R, T286A, E297K, I329V, Q334D, M357R, R358K, A371V, S379G, K390R, K395R, E396D, E399D  
>6003-30218| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIRKKDSGKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIELPEQDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGDGQWTYQIYQEPFKNLKTGKYARRKGA
HTNDVKQLTEVVQKIATEGIVIWGKTPKFRLPIQRDTWD

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006