<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6001 6001-30218 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, L90M L33F L10LI, T12TA, I13V, K20KR, M36I, N37D, I62V, L63P, H69K, A71AV  
>6001-30218| codons 1-99
PQITLWQRPIVAVKIGGQLREALLDTGADDTVFEEIDLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGKKVIGTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KE, Q151M A62V, V75I, F116Y G190Q V179D V21VI, V35T, S68X, K122E, I135V, T139TA, I202V, R211K, A272P, L283I, E297R, V317A, M357T, I375V, T386I  
>6001-30218| codons 1-399
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDXTEWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
DEDFRKYTAFTIPSVNNEAPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIDI
YQYMDDLYVQSDLEIGQHRTKVEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEVIPLTREAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEAVQKVATESIVIWGKIPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006