<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-5080 5080-30903 Greece 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, L210W, T215Y V75S, K219N K103N, Y181C V108I, K238T K11KR, K20R, V35VL, T39A, K43E, E44A, V60I, R83K, V118I, K122E, S162A, G196E, E203K, Q207E, R211K, K223Q, L228H, Q242H, A272P, K275R, I293V, P294Q, G333E, G359S, T369A, A371V, A376S, S379C, K390R  
>5080-30903| codons 1-399
PISPIETVPVRLKPGMDGPRVKQWPLTEEKIKALLEICAELEEAGKISKIGPENPYNTPI
FAIKKKNSTKWRKISDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIEQHRTKIKELREHLWKWGFYTPDNKHQQEPPFHWMGYELHPDTWT
VHPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVKQLCKLLRGTKALTEVVQLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEQGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLAEVVQKISTECIVIWGKTPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82S L24I, Q58E L10I, K20M, E35N, M36V, N37D, D60E, Q61QE, I62V, L63P, I64V, I85V  
>5080-30903| codons 1-99
PQITLWQRPIVTIKIGGQLMEALIDTGADDTVLENVDLPGRWKPKMIVGIGGFVKVREYE
EVPVEICGHKAIGTVLVGPTPSNIVGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006