<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1390 CA7768 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 156
2 AZT+DDI 25
3 AZT 82
4 3TC+D4T 17
5 3TC+D4T+SQV 13
6 3TC+D4T+IDV 72
7 3TC+AZT+RTV+SQV 35

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A, I84V   L10I, E34EQ, E35D, N37D, D60E, Q61E, L63P, A71I, I72T, V77I, I93L  
>CA7768| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLQDMDLPGRWKPKMIVGIGGFVKVRQYE
EIPIEICGHKITGTVLIGPTPANVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     V35T, T39A, K64H, T69N, Q174QR, D177E, I178M, Q207N, R211K, A272P, T286A, T290TA, I293V  
>CA7767| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPV
FAIHKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPEMVI
YQYVDDLYVGSDLEIGQHRTKIEELRNHLLKWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALAEVVPLTEEAE
LE

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005