<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-5071 5071-30807 Greece 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70G, L74V, M184V, T215Y D67G, V75M L100I, K103N   K20R, T39TA, I50IT, S68N, K102KN, K122E, D123E, I135T, S162SN, I178L, G196E, T200TA, E224D, A272P, K281R, I293V, P294T, E297R, V317A, F346FY, M357T, T369TA, E370D, A376T, T377L, T386A V381VIM
>5071-30807| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAEMEKEGKISKTGPENPYNTPV
FAIKKKGNTGWRKVMDFRELNKRTQDFWEVQLGIPHPAGIKNNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKQNPDLVI
YQYVDDLYVGSDLEIEQHRAKIEELRQHLLRWGFYTPDKKHQKDPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEVVTLTREAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQGQWTYQIYQEPYKNLKTGKYARTRGA
HTNDVKQLADAVQKITLESIMIWGKAPKFKLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82AT, L90M V11VI, G73S L10I, I13L, K20R, L24M, E35D, M36I, N37D, K55R, I62V, L63P, C67F, H69K, A71V, I72FL  
>5071-30807| codons 1-99
PQITLWQRPIITLKIGGQLREALMDTGADDTVLEDIDLPGRWKPKIIGGIGGFVRVRQYD
QVPIEIFGKKVLSTVLVGPTPTNIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006