<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-5058 5058-30930 Greece 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M L10LF, Q58E E35D, M36I, D60E, I62V, L63P, I64V, Q92R, I93L, C95F  
>5058-30930| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVREYE
QVPVEICGHKAIGTVLVGPTPVNIIGRNLMTRLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V T215C V106A, G190A F227L K43Q, E44D, K64R, K122E, G196E, H208Y, L210F, R211K, D218E, I293V, E297A, Q334E, Y342F, G359A, A371V, K390R  
>5058-30930| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQDGKISKIGPENPYNTPV
FAIRKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVASDLEIEQHRTKIEELRQYLFKWGFCTPEKKHQKEPPLLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGEGQWTYQIFQEPFKNLKTGKYARMRAA
HTNDVKQLTEVVQKIATESIVIWGKTPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006