<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-5056 5056-30903 Greece 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82A, L90M L33I, Q58E L10I, I13V, L19Q, K20R, E35D, M36I, N37D, K55KR, R57K, Q61D, I62V, L63P, I64V, A71V, I93L D60EQ
>5056-30903| codons 1-99
PQITLWQRPIVTVKIGGQQREALLDTGADDTVIEDIDLPGRWKPKIIGGIGGFVRVKEYQ
DVPVEICGHKVIGTVVVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, V75M, M184I, T215F F77FL, K219Q G190Q A98G S3SC, T39A, V60I, R83RK, V90I, I94IL, K122E, D123E, S162Y, Q174QR, V189VI, T200A, E203D, H208Y, R211K, L228LH, A272P, I293V, E297EK P157A
>5056-30903| codons 1-399
PICPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLMDLRELNKKTQDFWEIQLGLPHPGGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSAAIFQYSMTKILEPFRKRNPDIVI
YQYIDDLYIQSDLEIGQHRAKIDELRQYLLKWGFFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006