<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-5053 5053-30516 Greece 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, V82VA, I84V L10F, L24I, L33F, F53L, T74AP I13V, E34Q, M36L, D60E, I62V, L63P, I64V  
>5053-30516| codons 1-99
PQITLWQRPFVTVKIGGQLKEALIDTGADDTVFQELNLPGRWKPKIIGGIGGLMKVRQYE
QVPVEICGHKAIGPVLVGPTPANVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70KR, L74I, V75T, M184V, L210W, T215Y K219E L100I, K103S   K20R, V35I, T39A, E44D, V118I, K122E, D123E, S162D, D177G, G196E, T200A, E203K, H208Y, R211K, D218E, K223Q, L228H, Q242H, A272P, K277R, L283I, I293V, E297A, Y342F, G359S, A371V, A376S, S379C, K390R  
>5053-30516| codons 1-400
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTRWRKITDFRELNKRTQDFWEVQLGIPHPAGIKKSKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPGIVI
YQYVDDLYVGSDLEIEQHRAKIKELRQYLWKWGFYTPEEKHQQEPPFHWMGYELHPDKWT
VHPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIFQEPFKNLKTGKYARMRSA
HTNDVKQLTEVVQKISTECIVIWGKTPKFRLPIQKETWEA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006