<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-5048 5048-30515 Greece 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M F53L, Q58E L10I, K20R, E35D, M36I, N37A, I62V, L63P, A71V, V77I, I93L  
>5048-30515| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIALPGRWKPKMIGGIGGLVKVREYD
QVPIEICGHKVIGTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69G_SG, L210W, T215Y A62V K101E, Y181I, G190A A98G, V108I K43E, K64R, W88C, K122E, E138A, K166R, T200A, I202V, E203K, L228H, A272P, K277R, T286A, E297K, A376V, T386I  
>5048-30515| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEEEGKISKIGPENPYNTPV
FVIRKKDSGKWRKLVDFRELNKRTQDFCEVQLGIPHPGGLEKKKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
IQYMDDLYVASDLEIGQHRAKVKELRQHLWRWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIVTESIVIWGKIPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006