<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-5012 5012-30509 Greece 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L33F, K43T, G48W, F53L L10I, T12N, I13V, M36L, I62V, L63T, T74A, L89I  
>5012-30509| codons 1-99
PQITLWQRPIVNVKIGGQLKEALLDTGADDTVFEELNLPGRWTPKMIWGIGGLVKVRQYD
QVTIEICGHKAIGAVLVGPTPANIIGRNIMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67~, K70R, L74I, T215F T69G, K219Q   V108I K20R, T39D, V118I, K122E, I135T, T139TI, I142L, F214L, K223Q, L228H, T240TA, Q242H, V245M, A272P, R284RK, T286TA, I293V, K311R, V317VAG, M357I, G359S, A360T, V365I  
>5012-30509| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICDELEKEGKISKIGPENPYNTPV
FAIKKK~SGRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSTNNEIPGLRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFTPDQKHQQEPPFHWMGYELHPDKWA
VHPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGAKALTEVVPLTEEAE
LELAENREILREPVHGGYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARIRST
HTNDIKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006