<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-5011 5011-31014 Greece 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 22

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, L210W, T215Y V75A, K219R Y181C, G190A V108I K43E, E44D, K101Q, V118I, D121H, K122E, S162C, R172K, D177E, R211K, H221Y, A272P, A288S, I293V, Q334E, P345E, F346H, R356K, G359S, A360T, V365I, K390R, E399D  
>5011-31014| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEDGKISKIGPENPYNTPV
FAIKKKNSDKWRKVADFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTILDVGDAYFSIPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFKKQNPEIVI
CQYMDDLYVASDLEIGQHRTKIEELRQHLWKWGFYTPDRKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGEGQWTYQIYQEEHKNLKTGKYAKMRST
HTNDIKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V V11I, L24I, N83D I13V, K20R, A22V, E35D, M36I, K55R, R57K, Q61E, I62V, L63P, A71T, I72V T91TCS
>5011-31014| codons 1-99
PQITLWQRPLITVKIGGQLREVLIDTGADDTVLEDINLPGRWKPKIIGGIGGFVRVKQYD
EVPIEICGHKTVGTVLVGPTPVDVIGRNLLSQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006