<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-5009 5009-30811 Greece 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M G73T L10I, I15V, L19LQ, K20I, E35D, M36I, L63P, I64V, I85V  
>5009-30811| codons 1-99
PQITLWQRPIVTIKVGGQQIEALLDTGADDTVLEDINLPGRWKPKIIGGIGGFVKVRQYD
QIPVEICGHKAITTVLVGPTPVNVVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y       K49R, S68SG, V90I, A98S, V118I, D123E, I135IT, S162D, Q174K, T200A, V245M, A272P, E297A, L303M, Q334E, R356K, A376T, T386A, K390R  
>5009-30811| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISRIGPENPYNTPV
FAIKKKDGTKWRKVVDFRELNKRTQDFWEIQLGIPHPSGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKKNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTAEAE
LEMAENREILKEPVHGVYYDPSKDLIAEIQKQGEGQWTYQIYQEPFKNLKTGKYAKMRGA
HTNDVKQLTEAVQKITTESIVIWGKAPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006