<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-5007 5007-30626 Greece 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69A_EG, V75M, L210W, T215Y D67S K103N, Y181C   P4PS, T27TS, T39A, K122E, R211K, L228H, V245E, A288S, I293V, E297R, Q334E, M357S, A360T, A376S, K390R S68Q
>5007-30626| codons 1-399
PISSIETVPVKLKPGMDGPKVKQWPLSEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKSQAKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVVPLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGEGQWTYQIYQEPFKNLKTGKYARSRGT
HTNDVKQLTEAVQKISTESIVIWGKTPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, I54T, V82A L33I L10I, I13V, L19I, K20M, E35DN, M36I, N37D, I62V, L63P, I64V, T74S, N83S, T91TS  
>5007-30626| codons 1-99
PQITLWQRPIVTVKIGGQIMEALLDTGADDTVIENIDLPGRWKPKIIVGIGGFTKVRQYD
QVPVEICGHKAIGSVLVGPTPASIIGRNLLSQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006