<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-5005 5005-30422 Greece 2003 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IATV, V82VA, L90LM L33LF L10LI, I13V, K14KR, L19LI, K20KR, E35D, M36I, R41K, K45R, R57K, L63P, H69K, L89IM  
>5005-30422| codons 1-99
PQITLWQRPIVTVRIGGQIREALLDTGADDTVFEDINLPGKWKPRMIGGIGGFVKVKQYD
QIPIEICGKKAIGTVLVGPTPANIIGRNMMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006