<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2103 CA7758 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 313
2 AZT+DDI 52
3 AZT+DDC 52
4 AZT+D4T 52
5 3TC+D4T+SQV 52
6 3TC+D4T+IDV 61
7 3TC+D4T+IDV+SQV 34

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215F A62V, K219Q K103N   V35L, K64KR, K122E, K173E, I178L, V179VI, D218E, L228H  
>CA7758| codons 1-258
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTELEKEGKISKIGPENPYNTPV
FVIRKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPDLII
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWRWGFFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, V82A, L90M   L10I, I15V, E35D, M36I, N37S, R41K, L63P, A71V, I93L  
>CA7759| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDISLPGKWKPKMIVGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012