<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4391 4391-30625 Austria 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D_D, K70R, L74I, T215F A62V, V75T, K219Q K101P, K103N   K20R, E28EK, V35M, K64N, S68T, I202V, D218DE, A272P, T286A, P294T, E297Q, R356K, R358K, G359S, A371V, I375IV  
>4391-30625| codons 1-400
PISPIETVPVKLKPGMDGPRVKQWPLTKEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FVINKKDTDRWRKITDFRELNKRTQDFWEVQLGIPHPAGLPKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELRQHLLRWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVITLTQEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKMKSA
HTNDVKQLTEVVQKVATESIVIWGKTPKFKLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M Q58E L10I, L19I, K43R, L63P, A71V, I72V, V77I  
>4391-30625| codons 1-99
PQITLWQRPIVTIKIGGQIKEALLDTGADDTVLEEMNLPGRWRPKMIGGIGGFVKVREYD
QIPIEICGHKVVGTVLIGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006