<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4286 4286-30910 Germany 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69~, L74V, Y115F, Q151M, M184V, L210W, T215Y F116Y, K219E K101E, Y181C, G190S V108I V35T, T39A, S48E, V60I, S68G, D123E, R172K, K173A, Q174K, D177E, I178M, G196GE, T200A, Q207A, R211K, H221HY, L228H, P243A, V245Q, E248D, D250S, A272P, K275R, Q278N, T286A, E291D, I293V, E297A, R307RK, D324E, Q334H, G335D, F346H, R356K, M357K, G359S, A371V, I375V, T386I, K390R  
>4286-30910| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAELEKEGKIEKIGPENPYNTPI
FAIKKKNG~KWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTILDVGDAFYSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFKAKNPEMVI
CQYVDDLYVSSDLEIEQHRAKIEELRAHLWKWGFYTPDEKYQKEPPFHWMGYELHPDKWT
VQAIQLPDKSSWTVNDIQKLVGKLNWASQIYPGIRVKNLCKLLRGAKALTDVVPLTAEAE
LELAENKEILKEPVHGVYYDPSKELIAEIQKQGHDQWTYQIYQEPHKNLKTGKYAKKRSA
HTNDVKQLTEVVQKVATESIVIWGKIPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54AV, V82F, L90M L33F, K43T, F53L L10IV, G16E, L19I, K20R, E35D, M36I, N37T, P39T, R41K, D60E, Q61E, I62V, L63P, I64V, H69Q, A71V, I93L  
>4286-30910| codons 1-99
PQITLWQRPVVTIKIEGQIREALLDTGADDTVFEDITLTGKWTPKMIGGIGGLVKVRQYE
EVPVEICGQKVIGTVLVGPTPFNIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006