<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4267 4267-40518 Germany 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 47

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, T215Y V75M, K219Q K101P, G190A Y318F E6N, V35I, K43Q, E44D, K73M, I94L, V118I, K122E, D123E, S162D, D177E, I178M, V179I, E203G, Q207E, H208Y, L210Y, R211K, D218E, L228H, Q242H, V245K, I293V, R358K, I375V, A376S, T386I, K390R, K395R, E399D I159L
>4267-40518| codons 1-400
PISPINTVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEQDGKISKIGPENPYNTPV
FAIKKKNSTRWRMIMDFRELNKRTQDFWEVQLGLPHPAGLPKKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPALFQDSMTKILEPFRKQNPEMII
YQYVDDLYVASDLEIGQHRTKIGELREYLYKWGFYTPEQKHQKEPPFHWMGYELHPDKWT
VHPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVFYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMKGA
HTNDVKQLTEAVQKVSTESIVIWGKIPKFRLPIQRETWDA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54T, V82VL, I84V, L90M L33I L10I, I13V, K20I, E34Q, E35G, M36I, L63P, I64V, T74S  
>4267-40518| codons 1-99
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVIQGINLPGRWKPKIIGGIGGFTKVRQYD
QIPVEICGHKAIGSVLVGPTPLNVIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006