<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4264 4264-30616 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70KR, L74I, M184V, T215F V75T, K219Q     K20R, I94IL, K101Q, V118I, K122E, I135L, Q174R, D177E, G196E, T200TA, E203D, F214L, K223Q, L228H, A272P, K277R, A288S, E297K, G333E, M357I, A360T, K366KR, T386TI, K390R, E399D N137H
>4264-30616| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKITDFRELNKRTQDFWEVQLGLPHPAGLQKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSLNHETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPEIVI
YQYVDDLYVGSDLEIEQHRAKIDELRQHLLRWGLFTPDQKHQQEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKSLTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEQGQWTYQIYQEPFKNLKTGKYARIRGT
HTNDVRQLTEAVQKIATESIVIWGKIPKFRLPIQKETWD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, V82T, L90M L10F, L89V T12K, I13V, Q18H, K20I, E35ED, M36I, N37DE, R41E, K55R, D60K, I62V, L63P, C67F, H69R, A71V  
>4264-30616| codons 1-99
PQITLWQRPFVKVKIGGHLIEALLDTGADDTVLEDIELPGEWKPKIIGGVGGFVRVRQYK
QVPIEIFGRKVIGTVLVGPTPTNIIGRNVMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006