<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4261 4261-30530 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V, I84V, L90M L10F, V11VI, L33I, Q58E, L89V I13V, Q18QH, K20M, M36I, I62V, L63P, A71T, P79A, T91S, Q92K  
>4261-30530| codons 1-99
PQITLWQRPFITVKIGGHLMEALLDTGADDTVIEEINLPGRWKPKIIGGIGGFIKVREYD
QVPIEICGHKTIGTVVVGATPVNVIGRNVMSKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69A_XG, L210W, T215HY D67DE, V75M Y181C, G190A   S68G, K101Q, V106VI, K122E, I135T, I142V, S163SAGT, L228K, K277R, Q278QE, L283LI, E297K, Q334L, M357I, A360T, T386I  
>4261-30530| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKEGAKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLQKKKSITVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSTMTKILEPFRKQNPDIVI
CQYMDDLYVASDLEIGQHRTKIEELRQHLWRWGFYTPDKKHQKEPPFKWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRELCKLIRGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGLGQWTYQIYQEPFKNLKTGKYARIRGT
HTNDVKQLTEAVQKIATESIVIWGKIPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006