<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2099 CA7749 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 4
2 3TC+D4T 30
3 3TC+D4T+IDV 52
4 ADV+NVP+NFV+SQV 47

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L10FI, L24LI I15V, K20R, E35D, M36I, R41K, R57K, I62V, L63C, A71V, L89M, I93L  
>CA7749| codons 1-99
PQITLWQRPFVTIKVGGQLREALIDTGADDTVLEDINLPGKWKPKLIGGIGGFVKVKQYD
QVCIEICGHKVIGTVLVGPTPANIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215HY K219KN K103N, Y181YC   A98S, A158AS, E169ED, D177E, Q197E, R211K  
>CA7748| codons 1-255
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILDPFRKQNPEIVI
CQYMDDLYVGSDLEIGEHRTKIEELRQHLWKWGFHTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVN

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005