<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4258 4258-30909 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219E, N348I L100I, K103N   V90I, A158S, S162Y, T200A, V245N, A288T, I293V, E297K, K311R, I326V, G359S, K390R  
>4258-30909| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQYSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFFTPDEKHQKEPPFLWMGYELHPDKWT
VQPINLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKTLTEVVPLTKEAE
LELAENREILREPVHGVYYDPSKDLVAEIQKQGQGQWTYQIYQEPFKILKTGKYARMRSA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54IL, V82A L24I, L33F, G73S L10IV, I13IV, I62V, L63P, A71V, Q92QK  
>4258-30909| codons 1-99
PQITLWQRPVVTVKIGGQLKEALIDTGADDTVFEEMNLPGRWKPKLIGGIGGFLKVRQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLLTKIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006