<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4257 4257-30729 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A, L90M G73T L10LI, E35D, M36I, I62V, L63P, A71V, I72L  
>4257-30729| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVLTTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70KR, M184V, T215F K219E K103N V108I K101Q, K122E, I202V, Q207E, L210F, R211RK, A272P, I293V, I329V, A371I  
>4257-30729| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELREHLFKWGFFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEIVQKIATESIVIWGKTPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006