<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4252 4252-30528 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        R83RK, V90I, S162Y, V179I, T200IR, R211K, V245VI, D250E, A272P, K277KR, T286A, I293IV, E297KT, I329L, G333GE, Q334QP, M357MT, I375M, T386I  
>4252-30528| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLEIGQHRRKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIILPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVVPLTTEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQEPGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEAVQKMATESIVIWGKIPKFKLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13IV, G16GE, E35D, I62IV, L63HPQ, I64IM, C67CDGY  
>4252-30528| codons 1-99
PQITLWQRPIVTVKIEGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QVQMEIYGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006