<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4244 4244-30513 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179D I31L, K103R, S162C, E169D, Q207E, K277R, Q334N, A360T, V365I, A376S  
>4244-30513| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPDIDI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGNGQWTYQIYQEPFKNLKTGKYARMRGT
HTNDIKQLTEAVQKISTESIVIWGKTPKFKLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37S, L63P  
>4244-30513| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006