<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4241 4241-40707 Germany 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 59

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54A N88D, L89V L10I, I13V, Q18H, K20M, L33V, N37D, K55R, L63P, I66V, A71I, I72V, V77VI, Q92K  
>4241-40707| codons 1-99
PQITLWQRPIVTVKIGGHLMEALLDTGADDTVVEEMDLPGRWKPKIVGGIGGFARVRQYD
QIPIEVCGHKIVGTVLIGPTPVNIIGRDVLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70KR, Q151M, M184V A62V, V75I, F77L, F116Y, K219Q Y181C, G190GA A98G E28R, V35M, I50IV, K101A, V118I, K122KE, T165TI, D177DE, E203K, Q207E, F214L, K277R, E291D, I293V, M357V, T369V, A376T, V381I, T386A, K390R  
>4241-40707| codons 2-399
ISPIETVPVKLKPGMDGPKVKQWPLTREKIKALMEICTEMEKEGKISKVGPENPYNTPVF
VIKKKNSDRWRKLIDLRELNKRTQDFWEVQLGIPHPGGLAKKKSVTVLDVGDAYYSIPLD
EDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMIKILEPFRKQNPEIVIC
QYVDDLYVASDLEIGQHRTKIKELREHLLRWGLTTPDQKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTDVVPLTEEAEL
ELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARVRGAH
TNDVKQLVEAVQKITTESIIIWGKAPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006