<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4229 4229-30507 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46LV, I84V L33LF L10LI, I62MV, L63P, H69N, V82I  
>4229-30507| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKVIGGIGGFIKVRQYD
QVPIEICGNKAIGTVLVGPTPINVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70KR, M184V       E6D, D123E, I135L, K173E, I178M, A272P, K277R, P294T, E297K, I329V, T338S, M357T, A371V, A376T, T386A, K390R  
>4229-30507| codons 1-399
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPDMVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVITLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGQGQWSYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEVVQKITTESIVIWGKAPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006