<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4222 4222-30506 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, V75M, M184V, L210W, T215Y D67DG, F77L, K219R K103N A98G, V108I, F227L V35T, T39I, E44D, V60I, V118I, K122E, D123DN, I135T, G196E, T200A, E203K, H208Y, R211K, K223E, L228R, V245M, A272P, K277R, T286A, E297KR, D324E, I329L, M357T, E370D, S379C V111VIM
>4222-30506| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICIELEKDGKISKIGPENPYNTPI
FAIKKKGSDKWRKLMDLRELNKRTQDFWEVQLGIPHPGGLKKNKSVTILDMGDAYFSIPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRAKIKELRQYLWKWGFYTPDRKHQEEPPLRWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTREAE
LELAENREILKEPVHGVYYDPSKELIAELQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTDAVQKIATECIVIWGKTPKFKLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, L33F, G73C T4TP, E35D, M36I, N37E, I62V, L63P, I66V, I72K, I93L, C95F  
>4222-30506| codons 1-99
PQIPLWQRPFVTIKIGGQLKEALLDTGADDTVFEDIELPGRWKPKIIGGIGGFVKVRQYD
QVPIEVCGHKAKCTVLVGPTPVNVIGRNLMTQLGFTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006