<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4220 4220-40504 Germany 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 54

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48M, I54S, V82T, I84V L33F L10I, I13V, F53Y, I62V, L63P, I72V, T74S, V77VI, I93L A71F, P79PHSY
>4220-40504| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKLIMGIGGYSKVRQYD
QVPIEICGHKFVGSVLIGYTPTNVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, T215Y K219E Y181C   K20R, K122E, D123E, E203EK, V245K, A272P, L283LI, T286TA, I326V, Q334N, R356K, G359S, T369V, A376S, K390R  
>4220-40504| codons 1-400
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVGSDLEIGQHRTKIKELRQHLLRWGFYTPDEKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGNGQWTYQIYQEPFKNLKTGKYAKMRSA
HTNDVKQLVEAVQKISTESIVIWGKTPKFRLPIQKETWEA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006