<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4219 4219-30423 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN, M46MI, I54V, V82VAIT, L90LM L10FI, L33LF, F53FL, N88D T12TP, I13V, I15IV, G16E, K20KT, E35EG, M36X, R41RK, K45T, I62V, L63S, I64IV, C67CY, A71AV, I72IV, V77VI, I93IL  
>4219-30423| codons 1-99
PQITLWQRPIVPVKVEGQLTEALLDTGADNTVFEGVNLPGKWKPTIIGGIGGLVKVRQYD
QVSVEIYGHKVVGTVLIGPTPTNIIGRDLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67DN, L210LW T215TN, K219N Y181YC, G190GA K101KHNQ K43KN, K122KE, A272P, K277R, A288AS, Q334E, M357MT, A360AT, K366KR, T369AV, A371AT, I375V, I393IM, A400S  
>4219-30423| codons 2-400
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPVF
AIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPLD
EDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIC
QYMDDLYVASDLEIGQHRTKIEELRQHLWRWGFNTPDNKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKSLTEVIPLTEEAEL
ELAENREILKEPVHGVYYDPSKDLIAEIQKQGEGQWTYQIYQEPFKNLKTGKYARTRGTH
TNDVRQLVETVQKVATESIVIWGKTPKFKLPMQKETWES

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006