<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4213 4213-30429 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, V82A, L90M L10F, L33F, Q58E, L89V I13V, K20V, E35G, M36I, N37D, R57K, D60E, I62V, L63P, A71T, Q92K  
>4213-30429| codons 1-99
PQITLWQRPFVTVKIGGQLVEALLDTGADDTVFEGIDLPGRWKPKMIGGIGGFLKVKEYE
QVPIEICGHKTIGTVLVGPTPANIIGRNVMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V, T215F K219Q K103N K238T K20R, V35L, T39A, V118I, K122E, I135T, I142V, K173T, Q174K, G196E, Q207H, R211K, F214L, K223KR, P294Q, V317A, G333GE, Q334L, G359S, T369A, A371V, A376ST, S379C, T386TA, K390R, E399D  
>4213-30429| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALLEICAEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRHHLLKWGLFTPDQKHQREPPFLWMGYELHPDTWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIQLTEEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQELGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLAEVVQKITTECIVIWGKAPKFRLPIQKETWD

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006