<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1455 CA7736 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 183
2 D4T 56
3 SQV+ D4T 21
4 DDC+NFV+NVP 90
5 SQV+ RTV+ EFV+ ABC 27

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, L74V, T215Y D67G, K219E K101E, Y181V, G190A   E28A, V60I, S68G, K122E, I135T, I178M  
>CA7736| codons 1-272
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKGGTRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
VQYMDDLYVASDLEIGQHRTKIEELRQHLLRWGFYTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73S L10I, I15V, L19P, K20I, E35D, M36I, R41K, I62V, L63P, A71V  
>CA7737| codons 1-99
PQITLWQRPIVTIKVGGQPIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012