<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4192 4192-30508 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I50IV, I54AV, V82A, L90M L33F, G73GS I3IF, L10I, I62V, L63P, A71V, V77I, I93L  
>4192-30508| codons 1-99
PQFTLWQRPIVTIKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKMIVGVGGFVKVRQYD
QVPIEICGHKVISTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y   K103N   P4PS, K20R, K122E, D123N, I178L, V189VI, T200A, E203D, Q207E, A272P, T286A, S322SA, Q334V, T338TS, R356K, M357K, K390R, Q394L  
>4192-30508| codons 1-399
PISSIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYVDDLYIGSDLEIGQHRAKIDELREHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPAKDLIAEIQKQGVGQWSYQIYQEPFKNLKTGKYAKKRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPILKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006