<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4181 4181-30623 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69G_SG, L210W, T215FY A62V, V75I K103N, Y181C, G190A A98G K20R, K64R, K122E, S163A, T200A, Q207E, L228H, V245E, A272P, K277R, L283I, A288S, I293V, E297A, D324E, G335C, M357V, T369S, A371V, I375V, K390R  
>4181-30623| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIRKKDSGKWRKLIDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSAMTKILEPFRKQNPDIVI
CQYMDDLYVASDLEIGQHRAKIEELREHLWRWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKSLTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQCQWTYQIYQEPFKNLKTGKYARVRGA
HTNDVKQLSEVVQKVATESIVIWGKTPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54M, L76V, I84V, L90M V11I, G73T, L89V L10I, I15V, G16A, K20I, M36I, N37D, L63P, A71V, V82I, I85V  
>4181-30623| codons 1-99
PQITLWQRPIITIKVAGQLIEALLDTGADDTVLEEIDLPGRWKPKIVGGIGGFMKVRQYD
QIPIEICGHKVITTVVVGPTPINVVGRNVMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006