<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4169 4169-30409 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, T69S_SS, L210W, T215CY   Y188L   P4S, E6D, V35VI, V106I, K122E, I135V, K173Q, Q174QK, T200I, Q207E, R211K, E224K, V245EK, K275KR, L283I, I293V, E297K, M357MR, A371V  
>4169-30409| codons 1-400
PISSIDTVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRQKNPDIVI
YQYMDDLLVGSDLEIGQHRIKIEELREHLWKWGFYTPDKKHQKKPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIRVKQLCKLIRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARRRGA
HTNDVKQLTEVVQKIATESIVIWGKTPKFKLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L76V, V82F, L90M L33F L10I, I13V, K14R, M36I, I62V, L63P, I64V, A71V, I93L  
>4169-30409| codons 1-99
PQITLWQRPIVTVRIGGQLKEALLDTGADDTVFEEINLPGRWKPKMIGGIGGFVKVRQYD
QVPVEICGHKVIGTVVVGPTPFNIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006