<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2092 CA7731 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 AZT+DDC+SQV 52
3 3TC+AZT+IDV 13
4 D4T+DDI+IDV 26
5 3TC+AZT+DLV+IDV 107

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A, L90M G73T L10I, K45R, L63P, A71V, I93L  
>CA7731| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPRMIGGIGGFIKVRQYD
QIPIEICGHKVITTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, V75M, M184V, L210W, T215F K219Q K103N Y318F T39A, E44ED, V60I, K122E, I142V, D177E, I178M, I195L, G196E, E203D, H208Y, R211Q, D218E, A272P, L283I, V317A, Q334L, R356K, G359S, A371V, K390R, A400T, R461K, L469I, Q480E, E529ED, A554S  
>CA7730| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPI
FAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYVDDLYVGSDLELEQHRTKIDELRQYLWQWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEVIPLTEEAE
LELAENREILKEPVHGAFYDPSKDLIAEIQKQGLGQWTYQIYQEPFKNLKTGKYAKMRSA
HTNDVKQLTEVVQKIATESIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDKGRQKVVSITDTTNQKTELE
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKDKVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005