<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4167 4167-40203 Germany 2004 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 41

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215F     A98G V35T, T39D, V60I, V118I, K122E, D123N, I135V, K173I, Q174K, D177E, T200A, Q207G, R211K, V245K, D250E, K277R, T286A, E291D, V292I, I293V, D324E, I326V, G335D, R356K, M357R, R358K, G359S, K366R, A371V, I375V, T377Q, K395R  
>4167-40203| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICDELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRGHLWKWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKELVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKRKSA
HTNDVRQLTEVVQKVAQESIVIWGKTPKFKLPIQRETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, I84V   L10I, I13A, A22V, E35D, M36I, N37S, R41K, D60E, I66F, H69K, A71V, L89I, T91S, Q92K  
>4167-40203| codons 1-99
PQITLWQRPIVTAKIGGQLKEVLLDTGADDTVLEDISLPGKWKPKLIGGIGGFVKVRQYE
QILIEFCGKKVIGTVLVGPTPVNVIGRNILSKIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006