<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4163 4163-30403 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L33I, Q58E, T74P L10I, V11L, I13V, Q18H, A22V, E35D, M36I, N37D, I62V, L63P, H69R, A71V, Q92K  
>4163-30403| codons 1-99
PQITLWQRPILTVKIGGHLKEVLLDTGADDTVIEDIDLPGRWKPKIIGGIGGFVKVREYD
QVPIEICGRKVIGPVLVGPTPVNVIGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_SG, L210W, T215Y       K64R, W88S, K122E, D123N, I178IL, Q197E, T200I, R211K, A272S, I293V, A327V, A355E, M357T, K366R, T386I, K390R  
>4163-30403| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIRKKDSSKWRKLVDFRELNKRTQDFSEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGEHRIKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIVEIQKQGQGQWTYQIYQEPFKNLKTGKYERTRGA
HTNDVRQLTEAVQKIATESIVIWGKIPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006