<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4147 4147-30325 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I50V, I54L, L90M L33I, K43T, L89V T12S, I13V, K20T, E35D, M36I, N37DE, L63P, A71IV, V77L, P79S, V82I, I93L  
>4147-30325| codons 1-99
PQITLWQRPLVSVKIGGQLTEALLDTGADDTIIEDIELPGRWTPKIVGGVGGFLKVRQYD
QIPIEICGHKVIGTVLLGSTPINIIGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_XG, L74V, M184MI, T215HY D67S K103KN, Y181C, G190GA K101H, V108I E28K, K32E, V90I, K122E, D123E, I135T, A158S, K166R, V189I, G196E, T200A, I202V, E204K, A272P, K277R, E297K, M357T, A360T, K390R N175E
>4147-30325| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKSSSKWRKVVDFRELNKRTQDFWEIQLGIPHPAGLHKNKSVTILDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPSIFQSSMTRILEPFRKQEPDIVI
CQYIDDLYIASDLEIEQHRAKVEKLRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGT
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006