<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4143 4143-30408 Germany 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, T215F V75M, K219Q     E6N, K11T, V35T, E36A, T39K, K43E, V60I, V90I, K122E, D123NS, I135V, I142V, S162H, K173S, D177E, V179I, I202V, Q207A, L228H, V245Q, E248D, D250DE, A272P, T286A, E291D, V292VI, I293V, P294T, E312D, G335D, M357K, G359S, K366R, T369V, E370D, A371V, I375V, A376V, T377M, T386A  
>4143-30408| codons 1-399
PISPINTVPVTLKPGMDGPKVKQWPLTEEKIKALTAICKELEEEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLMDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQHSMTKILEPFRSQNPEIII
YQYMDDLYVGSDLEIGQHRTKVEELRAHLLRWGFFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVRQLVDVVQKVVMESIVIWGKAPKFKLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54A, V82S   L10V, I15V, L19I, K20R, E35D, M36I, R41K, I62V, L63V, H69K, T74S, L89M, I93L  
>4143-30408| codons 1-99
PQITLWQRPVVTIKVGGQIREALLDTGADDTVLEDINLPGKWKPKMIVGIGGFAKVRQYD
QVVIEICGKKAIGSVLVGPTPSNIIGRNMLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006