<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4141 4141-30326 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y A62AV, V75T, K219N Y181C V108VI V35M, T39A, K43E, E44EA, K101Q, V118I, K122E, D123E, K173E, Q174R, I178L, T200A, Q207E, D218E, A272P, D324E, I326M, G335D, M357R, A371V, T386I, K390R  
>4141-30326| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEEAGKISKIGPENPYNTPV
FVIKKKNSTKWRKITDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTILDVGDAYFSIPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRERNPDLVI
CQYVDDLYVGSDLEIGQHRAKIEELREHLWRWGFYTPENKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKELMAEIQKQGQDQWTYQIYQEPFKNLKTGKYARRRGA
HTNDVKQLTEVVQKIATESIVIWGKIPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, I84V, L90M L10F, L33F, G73T G16A, N37D, I62V, L63P, A71V, P79A, I93L  
>4141-30326| codons 1-99
PQITLWQRPFVTIKIAGQLKEALLDTGADDTVFEEMDLPGRWKPKIVGGIGGFVKVRQYD
QVPIEICGHKVITTVLVGATPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006