<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2090 CA7724 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 ABC+ADV+IDV+NVP 73

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, D67N, T69D, K70R A62V, V75I, T215V, K219Q K103T, V106A, Y181YC   V35L, C38CS, V90I, K122E, I135T, G196E, Q207E, F214L, E224D, L228R, A288T, E297K  
>CA7724| codons 32-303
KALLEICTEMEKEGKISKIGPENPYNTPVFVIKRKNSDRWRKLIDFRELNKRTQDFWEIQ
LGIPHPAGLKKTKSATVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQ
GWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIEQHRTKIEELREHLLR
WGLVTPDQKHQKDPPFRWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIY
AGIKVKQLCKLLRGTKTLTEVIPLTKEAELEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   L10I, K20R, M36I, N37D, I62V, L63P, E65EG, A71V, T74S, I85V, I93L  
>CA7725| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFVKVRQYD
QVPIGICGHKVIGSVLVGPTPANIVGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005